PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03942.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 345aa    MW: 38592.2 Da    PI: 10.474
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03942.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.82.9e-0994139347
                                     SS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHHH CS
                 Myb_DNA-binding   3 rWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqky 47 
                                     +WT+ E +++ +a + l  +  +W+++ar ++ gRt  +++++++++
  Zmw_sc03942.1.g00020.1.sm.mkhc  94 SWTAKENKQFERALAALDLRrpDWEKVARAIP-GRTVGEIVDHYRSL 139
                                     7*****************99************.***********975 PP

2Myb_DNA-binding47.54.2e-15209253347
                                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                 Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                     +WT+eE+ l++ + k++G+g+W++I+r++  +Rt+ q+ s+ qky
  Zmw_sc03942.1.g00020.1.sm.mkhc 209 PWTEEEHRLFLLGLKKYGKGDWRSISRYFVHTRTPTQVASHAQKY 253
                                     8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.57890144IPR017884SANT domain
SMARTSM007172.0E-591142IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-493139IPR009057Homeodomain-like
SuperFamilySSF466891.2E-894146IPR009057Homeodomain-like
CDDcd001674.07E-794139No hitNo description
PfamPF002497.3E-794139IPR001005SANT/Myb domain
PROSITE profilePS5129419.812202258IPR017930Myb domain
SuperFamilySSF466896.9E-18203258IPR009057Homeodomain-like
TIGRFAMsTIGR015576.6E-17205256IPR006447Myb domain, plants
SMARTSM007171.8E-13206256IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-12206252IPR009057Homeodomain-like
CDDcd001676.57E-11209254No hitNo description
PfamPF002495.0E-13209253IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MQLETRRGEG RGNSPSEKTE NRGRSPFVLL APEDILFLPR EIKERRSSAE QRSTQKNGTA  60
SALEMMREAY MEVLPAMDHY ASRSNNWFLG PPRSWTAKEN KQFERALAAL DLRRPDWEKV  120
ARAIPGRTVG EIVDHYRSLE VDVRRIESGA MMPFSGYGGG GGANAFTLQW DGKGGHGAGD  180
FRHGYRFAGG CGKRHPGLTP EQERKKGVPW TEEEHRLFLL GLKKYGKGDW RSISRYFVHT  240
RTPTQVASHA QKYFIRRNSG GKDKRRSSIH DITTVNLNND QTPSPSQSSL ITNQPKASDQ  300
TAAASQFSLS ADTKQHGSAW SLAFEPLLPQ ASPLKRLNSQ LEAIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-1490162678RADIALIS
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968168.11e-130PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H74e-75DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA5HJS51e-151A5HJS5_9POAL; MYB_Al protein
STRINGSi002426m1e-129(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78863348